Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF736 Peptide - N-terminal region

ZNF736 Peptide - N-terminal region

Product Specifications

UniProt

B4DX44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF736 Rabbit Polyclonal Antibody (orb587852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HDIKDSFQKVILRKYGSCDLNNLHLKKDYQSVGNCKGQKSSYNGLHQCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR302c Human qPCR Template Standard (MI0000773)
HK300290 200 Reactions

MIR302c Human qPCR Template Standard (MI0000773)

Sign In for Pricing
View Details
Human Interleukin 7 Receptor (IL7R) ELISA Kit
orb1665383-01 48 Tests

Human Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 7 Receptor (IL7R) ELISA Kit
orb1665383-02 96 Tests

Human Interleukin 7 Receptor (IL7R) ELISA Kit

Sign In for Pricing
View Details
Anti-ADAMDEC1 (1G2)
YF-MA18197 100 ug

Anti-ADAMDEC1 (1G2)

Sign In for Pricing
View Details
KATNA1 Human Over-expression Lysate
orb1367641 20 µg

KATNA1 Human Over-expression Lysate

Sign In for Pricing
View Details
CFL1 Antibody
CSB-PA933261-01 50 μL

CFL1 Antibody

Sign In for Pricing
View Details