Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF736 Peptide - N-terminal region

ZNF736 Peptide - N-terminal region

Product Specifications

UniProt

B4DX44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF736 Rabbit Polyclonal Antibody (orb587852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001164376

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HDIKDSFQKVILRKYGSCDLNNLHLKKDYQSVGNCKGQKSSYNGLHQCLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Estrogen Inducible Protein pS2 Antibody / TFF1
orb2639233 7 mL

Estrogen Inducible Protein pS2 Antibody / TFF1

Sign In for Pricing
View Details
TRIM64 Rabbit Polyclonal Antibody (APC)
orb1002904 100 µL

TRIM64 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DSP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0634805 3x 1.0 µg

DSP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HHR23A Polyclonal Antibody, APC Conjugated
bs-15481R-APC 100 µL

HHR23A Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
BCL3 Conjugated Antibody
orb1620896 100 µL

BCL3 Conjugated Antibody

Sign In for Pricing
View Details
IC Anion Std Succinate 1000ppm in H2O - 500ML
ICAB24 500 mL

IC Anion Std Succinate 1000ppm in H2O - 500ML

Sign In for Pricing
View Details