Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA2 Peptide - N-terminal region

GRIA2 Peptide - N-terminal region

Product Specifications

UniProt

F8W7L6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIA2 Rabbit Polyclonal Antibody (orb575345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS804328 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
AP02704PU-S 50 µL

AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM3C (NM_001040020) Human Over-expression Lysate
LC421876 20 µg

FAM3C (NM_001040020) Human Over-expression Lysate

Sign In for Pricing
View Details
Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG
1310000-25-50.1G 1 g

Ɑ-Biotinamido-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
MAVS Rabbit Polyclonal Antibody
AP07387PU-N 50 µg

MAVS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C5orf46 activation kit by CRISPRa
GA118046 1 Kit

Human C5orf46 activation kit by CRISPRa

Sign In for Pricing
View Details