Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA2 Peptide - N-terminal region

GRIA2 Peptide - N-terminal region

Product Specifications

UniProt

F8W7L6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIA2 Rabbit Polyclonal Antibody (orb575345) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR2A Mouse Monoclonal Antibody [A7C8]
HA601091 100 µL

ACVR2A Mouse Monoclonal Antibody [A7C8]

Sign In for Pricing
View Details
C9orf117 (CFAP157) (NM_001012502) Human Over-expression Lysate
LC422870 20 µg

C9orf117 (CFAP157) (NM_001012502) Human Over-expression Lysate

Sign In for Pricing
View Details
Flufenacet
TRC-F599420-1G 1 g

Flufenacet

Sign In for Pricing
View Details
PE/AF594 Anti-Mouse TER-119 Antibody
RD30293F-01 25 µg

PE/AF594 Anti-Mouse TER-119 Antibody

Sign In for Pricing
View Details
PE/AF594 Anti-Mouse TER-119 Antibody
RD30293F-02 100 µg

PE/AF594 Anti-Mouse TER-119 Antibody

Sign In for Pricing
View Details
ViPrimePLUS Taq qPCR Green Master Mix I, 150rxns
QLMM12 150 Reactions

ViPrimePLUS Taq qPCR Green Master Mix I, 150rxns

Sign In for Pricing
View Details