Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grik1 Peptide - middle region

Grik1 Peptide - middle region

Product Specifications

UniProt

Q8C825

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIK1 Rabbit Polyclonal Antibody (orb575346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQTRWKHPSVDNRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPATCH2 Human Gene Knockout Kit (CRISPR)
KN420147 1 Kit

GPATCH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
BNC682884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
REPS2 (NM_001080975) Human Over-expression Lysate
LC421142 20 µg

REPS2 (NM_001080975) Human Over-expression Lysate

Sign In for Pricing
View Details
Ttc24 Mouse Gene Knockout Kit (CRISPR)
KN518405 1 Kit

Ttc24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RUVBL2 Rabbit Polyclonal Antibody
TA365865 100 µL

RUVBL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant TFF1/pS2 Monoclonal Antibody
AN301892L-01 50 µL

Recombinant TFF1/pS2 Monoclonal Antibody

Sign In for Pricing
View Details