Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grik1 Peptide - middle region

Grik1 Peptide - middle region

Product Specifications

UniProt

Q8C825

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRIK1 Rabbit Polyclonal Antibody (orb575346) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQTRWKHPSVDNRDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HO1 protein (His tag)
PDEH100857-01 20 µg

Recombinant Human HO1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human HO1 protein (His tag)
PDEH100857-02 100 µg

Recombinant Human HO1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human HO1 protein (His tag)
PDEH100857-03 500 µg

Recombinant Human HO1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human HO1 protein (His tag)
PDEH100857-04 1 mg

Recombinant Human HO1 protein (His tag)

Sign In for Pricing
View Details
Mouse Lum activation kit by CRISPRa
GA202514 1 Kit

Mouse Lum activation kit by CRISPRa

Sign In for Pricing
View Details
C9orf72 Recombinant Rabbit monoclonal Antibody
HA723290 100 µL

C9orf72 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details