Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB6 Peptide - middle region

EPHB6 Peptide - middle region

Product Specifications

UniProt

O15197

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHB6 Rabbit Polyclonal Antibody (orb575382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRLFSYTCPAVLRSFASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (BCR-Ig beta) (Biotin)
MBS6248768-01 0.1 mL

CD79b (BCR-Ig beta) (Biotin)

Sign In for Pricing
View Details
CD79b (BCR-Ig beta) (Biotin)
MBS6248768-02 5x 0.1 mL

CD79b (BCR-Ig beta) (Biotin)

Sign In for Pricing
View Details
POLR2I Conjugated Antibody
MBS9443599-01 0.1 mL (Biotin)

POLR2I Conjugated Antibody

Sign In for Pricing
View Details
POLR2I Conjugated Antibody
MBS9443599-02 0.1 mL (AF350)

POLR2I Conjugated Antibody

Sign In for Pricing
View Details
POLR2I Conjugated Antibody
MBS9443599-03 0.1 mL (AF405)

POLR2I Conjugated Antibody

Sign In for Pricing
View Details
POLR2I Conjugated Antibody
MBS9443599-04 0.1 mL (AF488)

POLR2I Conjugated Antibody

Sign In for Pricing
View Details