Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ11 Peptide - middle region

KCNJ11 Peptide - middle region

Product Specifications

Product Name Alternative

BIR, HHF2, IKATP, KIR6.2, PHHI, TNDM3

UniProt

Q14654

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNJ11 Rabbit Polyclonal Antibody (orb575394) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159762

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35D3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV621206 1.0 µg DNA

SLC35D3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PSG4, NT (PSG4, CGM4, PSG9, Pregnancy-specific beta-1-glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9) (Biotin)
MBS6338075-01 0.2 mL

PSG4, NT (PSG4, CGM4, PSG9, Pregnancy-specific beta-1-glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9) (Biotin)

Sign In for Pricing
View Details
PSG4, NT (PSG4, CGM4, PSG9, Pregnancy-specific beta-1-glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9) (Biotin)
MBS6338075-02 5x 0.2 mL

PSG4, NT (PSG4, CGM4, PSG9, Pregnancy-specific beta-1-glycoprotein 4, Pregnancy-specific beta-1-glycoprotein 9) (Biotin)

Sign In for Pricing
View Details
Phospho-RSK2 (Ser227) Rabbit pAb, PerCP-Cy7 conjugated
orb2852883 100 µL

Phospho-RSK2 (Ser227) Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Anti-AQP11 Antibody Picoband® (HRP Conjugate)
PB10044-HRP 100 µg/Vial

Anti-AQP11 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Ms4a6b (NM_027209) Mouse Untagged Clone
MC202193 10 µg

Ms4a6b (NM_027209) Mouse Untagged Clone

Sign In for Pricing
View Details