MTA1 Peptide - middle region
MTA1 Peptide - middle region
Product Specifications
UniProt
Q13330
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTA1 Rabbit Polyclonal Antibody (orb575603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTF
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-12943R-BF405 100 µL
CSNK1A1L Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details 
E45H00241-2 20 µg
YJEFN3 (NM_001190328) Human Over-expression Lysate
Sign In for Pricing
View Details