MTA1 Peptide - middle region
MTA1 Peptide - middle region
Product Specifications
UniProt
Q13330
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTA1 Rabbit Polyclonal Antibody (orb575603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTF
More Discoveries
Explore Other Products
Browse additional items from our catalog
PA1507-carrier-free 100 µg/Vial
Anti-Ribonuclease A/RNASE1 Antibody Picoband®, Carrier-free
Sign In for Pricing
View Details 
MBS6235670-01 0.1 mL
TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit
Sign In for Pricing
View Details 
MBS6235670-02 5x 0.1 mL
TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit
Sign In for Pricing
View Details 
K1138807 1.0 µg DNA
KIAA1210 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details MBS6346847-01 0.2 mL
SGEF, ID (ARHGEF26, SGEF, Rho guanine nucleotide exchange factor 26, SH3 domain-containing guanine exchange factor) (Biotin)
Sign In for Pricing
View Details