CERS4 Peptide - C-terminal region
CERS4 Peptide - C-terminal region
Product Specifications
UniProt
H0YKC9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CERS4 Rabbit Polyclonal Antibody (orb575758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPTDGPRSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Hemopexin Recombinant Rabbit Monoclonal Antibody [JU83-33]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81a7f/imageurl/et1706-10.webp)
ET1706-10 100 µL
Hemopexin Recombinant Rabbit Monoclonal Antibody [JU83-33]
Sign In for Pricing
View Details 
