Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECQL5 Peptide - C-terminal region

RECQL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RECQ5

UniProt

Q8WYH5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RECQL5 Rabbit Polyclonal Antibody (orb324642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPFYKEGKFASKELFKGFARHLSHLLTQKTSPGRSVKEEAQNLIRHFFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FTH1 protein, N-His Tag
MBS1560973-01 0.05 mg

Recombinant Human FTH1 protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Human FTH1 protein, N-His Tag
MBS1560973-02 0.1 mg

Recombinant Human FTH1 protein, N-His Tag

Sign In for Pricing
View Details
Recombinant Human FTH1 protein, N-His Tag
MBS1560973-03 5x 0.1 mg

Recombinant Human FTH1 protein, N-His Tag

Sign In for Pricing
View Details
DUXAP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV760340 1.0 µg DNA

DUXAP10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-AREB6/ZEB1 Antibody Picoband® (monoclonal, 8B12D7) Fluoro488 Conjugated
M00548-2-Fluoro488 100 µg/Vial

Anti-AREB6/ZEB1 Antibody Picoband® (monoclonal, 8B12D7) Fluoro488 Conjugated

Sign In for Pricing
View Details
LPAR4 Polyclonal Antibody
MBS2523162-01 0.02 mL

LPAR4 Polyclonal Antibody

Sign In for Pricing
View Details