Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECQL5 Peptide - C-terminal region

RECQL5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RECQ5

UniProt

Q8WYH5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RECQL5 Rabbit Polyclonal Antibody (orb324642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTPFYKEGKFASKELFKGFARHLSHLLTQKTSPGRSVKEEAQNLIRHFFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAC1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46048064 1.0 µg DNA

TAC1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) ELISA Kit
RDR-TGFb3-Hu-01 96 Tests

Human Transforming Growth Factor Beta 3 (TGFb3) ELISA Kit

Sign In for Pricing
View Details
Human Transforming Growth Factor Beta 3 (TGFb3) ELISA Kit
RDR-TGFb3-Hu-02 48 Tests

Human Transforming Growth Factor Beta 3 (TGFb3) ELISA Kit

Sign In for Pricing
View Details
Tnfaip6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3363403 1.0 µg DNA

Tnfaip6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC5, POLR3E ELISA Kit
MBS9342539-01 48 Well

Human DNA-directed RNA polymerase III subunit RPC5, POLR3E ELISA Kit

Sign In for Pricing
View Details
Human DNA-directed RNA polymerase III subunit RPC5, POLR3E ELISA Kit
MBS9342539-02 96 Well

Human DNA-directed RNA polymerase III subunit RPC5, POLR3E ELISA Kit

Sign In for Pricing
View Details