A1CF Peptide - N-terminal region
A1CF Peptide - N-terminal region
Product Specifications
UniProt
Q9NQ94
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with A1CF Rabbit Polyclonal Antibody (orb577910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-P999738-10MG 10 mg
Perfluorohexanesulfonic Acid (Technical Grade)
Sign In for Pricing
View Details 
