Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NLRX1 Peptide - N-terminal region

NLRX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLR11.3, DLNB26, NOD26, NOD5, NOD9

UniProt

Q86UT6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NLRX1 Rabbit Polyclonal Antibody (orb586183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_733840

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Loracarbef Monohydrate
TRC-L469553-25MG 25 mg

Loracarbef Monohydrate

Sign In for Pricing
View Details
6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine
TRC-C365187-50MG 50 mg

6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP629168 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
DNAH7 Human Gene Knockout Kit (CRISPR)
KN420114 1 Kit

DNAH7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp827 Mouse Gene Knockout Kit (CRISPR)
KN520001 1 Kit

Zfp827 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E4]
TA803357AM 100 µL

NR2C1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E4]

Sign In for Pricing
View Details