Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R43 Peptide - C-terminal region

TAS2R43 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T2R43, T2R52

UniProt

P59537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R43 Rabbit Polyclonal Antibody (orb587272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795365.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB515276 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
GAP43 pSer41 Rabbit Polyclonal Antibody
AP09476PU-N 100 µL

GAP43 pSer41 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse EpCAM Protein (His Tag)
PDEM100216-01 20 µg

Recombinant Mouse EpCAM Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse EpCAM Protein (His Tag)
PDEM100216-02 100 µg

Recombinant Mouse EpCAM Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse EpCAM Protein (His Tag)
PDEM100216-03 500 µg

Recombinant Mouse EpCAM Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse EpCAM Protein (His Tag)
PDEM100216-04 1 mg

Recombinant Mouse EpCAM Protein (His Tag)

Sign In for Pricing
View Details