OR9Q1 Peptide - C-terminal region
OR9Q1 Peptide - C-terminal region
Product Specifications
UniProt
Q8NGQ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR9Q1 Rabbit Polyclonal Antibody (orb587662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005212
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401045-500 1x 500 µL
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882052-100 1x 100 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942425-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2425), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 