Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A2 Peptide - C-terminal region

OR10A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR10A2P, OR11-82, OR11-86, OST363

UniProt

Q9H208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A2 Rabbit Polyclonal Antibody (orb327062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004460

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYISLSLTYFRPKSNNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USF1 Antibody, Biotin conjugated
A38123-100UG 100 µg

USF1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Sox10 (BC018551) AAV Particle
MR207447A1V 250 µL

Mouse Sox10 (BC018551) AAV Particle

Sign In for Pricing
View Details
DLPE-PEG-Silane
MPL0492K Each

DLPE-PEG-Silane

Sign In for Pricing
View Details
Rabbit Polyclonal TOP2A Antibody
NB110-40636 0.1 mL

Rabbit Polyclonal TOP2A Antibody

Sign In for Pricing
View Details
APPL1 Antibody
E035645 100 µg -100 µL

APPL1 Antibody

Sign In for Pricing
View Details
Goat F-box only protein 27 (FBXO27) ELISA Kit
MBS7235885-01 48 Well

Goat F-box only protein 27 (FBXO27) ELISA Kit

Sign In for Pricing
View Details