OR10A2 Peptide - middle region
OR10A2 Peptide - middle region
Product Specifications
Product Name Alternative
OR10A2P, OR11-82, OR11-86, OST363
UniProt
Q9H208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10A2 Rabbit Polyclonal Antibody (orb327064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004460
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-SLAMF7-Hu-01 96 Tests
Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit
Sign In for Pricing
View Details RDR-SLAMF7-Hu-02 48 Tests
Human Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) ELISA Kit
Sign In for Pricing
View Details 
![Elab Fluor® Violet 610 Anti-Mouse/Human CD11b Antibody[M1/70]](https://cdn.genprice.uk/products/763/68dd149b061270361e7cef8f/imageurl/e-ab-f1081ut.webp)
E-AB-F1081UT-01 25 µg
Elab Fluor® Violet 610 Anti-Mouse/Human CD11b Antibody[M1/70]
Sign In for Pricing
View Details E-AB-F1081UT-02 100 µg
Elab Fluor® Violet 610 Anti-Mouse/Human CD11b Antibody[M1/70]
Sign In for Pricing
View Details 
R-6803-1 1 mg
TRITC Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-
Sign In for Pricing
View Details