OR10A2 Peptide - middle region
OR10A2 Peptide - middle region
Product Specifications
Product Name Alternative
OR10A2P, OR11-82, OR11-86, OST363
UniProt
Q9H208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10A2 Rabbit Polyclonal Antibody (orb327064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004460
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSLR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-MSEL-M0121-01 24 Tests
Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0121-02 48 Tests
Mini Sample Mouse CD23 (Receptor II for the Fc Region of Immunoglobulin E) ELISA Kit
Sign In for Pricing
View Details