Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A7 Peptide - C-terminal region

OR10A7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR12-6

UniProt

Q8NGE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A7 Rabbit Polyclonal Antibody (orb587668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGAVKRTITQKVLQKLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152E-01 20 Tests

APC Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
APC Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152E-02 100 Tests

APC Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
APC Anti-Human CD127/IL-7RA Antibody[A019D5]
E-AB-F1152E-03 2x 100 Tests

APC Anti-Human CD127/IL-7RA Antibody[A019D5]

Sign In for Pricing
View Details
Anti-SZT2
Y058998 100 µg

Anti-SZT2

Sign In for Pricing
View Details
Human CA12 ELISA Kit 1 x 96
EA200026 96 Well

Human CA12 ELISA Kit 1 x 96

Sign In for Pricing
View Details
Col6a6 Mouse Gene Knockout Kit (CRISPR)
KN503650 1 Kit

Col6a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details