OR10A7 Peptide - C-terminal region
OR10A7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR12-6
UniProt
Q8NGE5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10A7 Rabbit Polyclonal Antibody (orb587668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005280
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGAVKRTITQKVLQKLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683135-100 1x 100 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3135R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![MDA5 (IFIH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C11]](https://cdn.genprice.uk/products/937/68dd1b79061270361ea1bb91/imageurl/ta803670bm.webp)
TA803670BM 100 µL
MDA5 (IFIH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C11]
Sign In for Pricing
View Details 
BNC880940-100 1x 100 µL
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Erythrocytes Mouse Monoclonal Antibody [Clone ID: OX-83]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd110/imageurl/am31837bt-n.webp)
AM31837BT-N 100 µg
Erythrocytes Mouse Monoclonal Antibody [Clone ID: OX-83]
Sign In for Pricing
View Details 
BNC402043-100 1x 100 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details