Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10H4 Peptide - middle region

OR10H4 Peptide - middle region

Product Specifications

Product Name Alternative

OR19-28

UniProt

Q8NGA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10H4 Rabbit Polyclonal Antibody (orb587675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004465

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC346416 Human qPCR Primer Pair (XM_294221)
HP221583 200 Reactions

LOC346416 Human qPCR Primer Pair (XM_294221)

Sign In for Pricing
View Details
Mouse Ptpn12 activation kit by CRISPRa
GA203474 1 Kit

Mouse Ptpn12 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF647 conjugate, 0.1mg/mL
BNC471372-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NAP 226-90-d6
TRC-N325002-1MG 1 mg

NAP 226-90-d6

Sign In for Pricing
View Details
Human IL-6R Antibody Pair Set
E-KAB-0279 50 µL & 100 µg

Human IL-6R Antibody Pair Set

Sign In for Pricing
View Details
Human Epigen (EPGN) activation kit by CRISPRa
GA116820 1 Kit

Human Epigen (EPGN) activation kit by CRISPRa

Sign In for Pricing
View Details