Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10H4 Peptide - middle region

OR10H4 Peptide - middle region

Product Specifications

Product Name Alternative

OR19-28

UniProt

Q8NGA5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10H4 Rabbit Polyclonal Antibody (orb587675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004465

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-8/CXCL8 Protein (aa 23-99)
PKSH033608-01 10 µg

Recombinant Human IL-8/CXCL8 Protein (aa 23-99)

Sign In for Pricing
View Details
Recombinant Human IL-8/CXCL8 Protein (aa 23-99)
PKSH033608-02 50 µg

Recombinant Human IL-8/CXCL8 Protein (aa 23-99)

Sign In for Pricing
View Details
SALL2 Rabbit Polyclonal Antibody
TA362836 100 µL

SALL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Deoxy-D-fructose-13C6
TRC-D235917-50MG 50 mg

3-Deoxy-D-fructose-13C6

Sign In for Pricing
View Details
BNIP2 (NM_004330) Human Over-expression Lysate
LC401378 20 µg

BNIP2 (NM_004330) Human Over-expression Lysate

Sign In for Pricing
View Details
HOMER3 (NM_001145721) Human Over-expression Lysate
LC428985 20 µg

HOMER3 (NM_001145721) Human Over-expression Lysate

Sign In for Pricing
View Details