Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51A2 Peptide - N-terminal region

OR51A2 Peptide - N-terminal region

Product Specifications

UniProt

Q8NGJ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51A2 Rabbit Polyclonal Antibody (orb587682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004748

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMLG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
14969066 1.0 µg DNA

CAMLG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Parp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4854005 3x 1.0 µg

Parp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Superoxide Dismutase (SOD) Activity Assay Kit
KB03011-400 400 Tests

Superoxide Dismutase (SOD) Activity Assay Kit

Sign In for Pricing
View Details
Donkey Anti-Goat IgG H&L Secondary Antibody-PE-CY5
TMAB-02004PC5-01 100 µL

Donkey Anti-Goat IgG H&L Secondary Antibody-PE-CY5

Sign In for Pricing
View Details
Donkey Anti-Goat IgG H&L Secondary Antibody-PE-CY5
TMAB-02004PC5-02 1 mL

Donkey Anti-Goat IgG H&L Secondary Antibody-PE-CY5

Sign In for Pricing
View Details
INHBE (Inhibin beta E Chain, Activin beta-E Chain, MGC4638)
MBS648751-01 0.05 mg

INHBE (Inhibin beta E Chain, Activin beta-E Chain, MGC4638)

Sign In for Pricing
View Details