Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51A2 Peptide - N-terminal region

OR51A2 Peptide - N-terminal region

Product Specifications

UniProt

Q8NGJ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51A2 Rabbit Polyclonal Antibody (orb587682) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004748

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASL12 Antibody; FITC conjugated
MBS7006389-01 0.05 mg

RASL12 Antibody; FITC conjugated

Sign In for Pricing
View Details
RASL12 Antibody; FITC conjugated
MBS7006389-02 0.1 mg

RASL12 Antibody; FITC conjugated

Sign In for Pricing
View Details
RASL12 Antibody; FITC conjugated
MBS7006389-03 5x 0.1 mg

RASL12 Antibody; FITC conjugated

Sign In for Pricing
View Details
Human CD10 Mouse mAb
orb2837374 100 µg

Human CD10 Mouse mAb

Sign In for Pricing
View Details
Nuclear Receptor Coactivator 3 (NCOA3) Magnetic Luminex Assay Kit
LKU604040 96 Tests

Nuclear Receptor Coactivator 3 (NCOA3) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
KIAA1161 Rabbit pAb, PE-Cy7 conjugated
orb2845122 100 µL

KIAA1161 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details