Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51A7 Peptide - C-terminal region

OR51A7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-27

UniProt

Q8NH64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51A7 Rabbit Polyclonal Antibody (orb587683) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004749

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPFPFTLRRLKYCQKNLLSHSYCLHQDTMKLACSDNKTNVIYGFFIALCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERINC2 (NM_018565) Human Over-expression Lysate
LY434248 100 µg

SERINC2 (NM_018565) Human Over-expression Lysate

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-01 20 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-02 60 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-03 120 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-04 200 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF449 (NM_152695) Human Over-expression Lysate
LC403487 20 µg

ZNF449 (NM_152695) Human Over-expression Lysate

Sign In for Pricing
View Details