Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51A7 Peptide - C-terminal region

OR51A7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-27

UniProt

Q8NH64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51A7 Rabbit Polyclonal Antibody (orb587683) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004749

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPFPFTLRRLKYCQKNLLSHSYCLHQDTMKLACSDNKTNVIYGFFIALCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL
BNC880925-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), 1mg/mL
BNUM0507-50 1x 50 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), 1mg/mL

Sign In for Pricing
View Details
Anti-IQCE
Y058881 100 µg

Anti-IQCE

Sign In for Pricing
View Details
Ethyl 4-Bromoacetoacetate
TRC-E900590-5G 5 g

Ethyl 4-Bromoacetoacetate

Sign In for Pricing
View Details
Recombinant CD35 Antibody
RC-5075-01 50 μL

Recombinant CD35 Antibody

Sign In for Pricing
View Details
Recombinant CD35 Antibody
RC-5075-02 100 µL

Recombinant CD35 Antibody

Sign In for Pricing
View Details