OR51S1 Peptide - C-terminal region
OR51S1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-24
UniProt
Q8NGJ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR51S1 Rabbit Polyclonal Antibody (orb587686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004758
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
104730P1-AAT 500 Tests
IFluor® 820 Anti-mouse/human/rat CD47 Antibody *MIAP410*
Sign In for Pricing
View Details NG20-B001 1 mL
Naked Gold® 20 nm Concentrated Gold Sol, 15 O.D./mL, 1 mL
Sign In for Pricing
View Details 
K3469806 1.0 µg DNA
Dnajc25 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
