OR51S1 Peptide - C-terminal region
OR51S1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-24
UniProt
Q8NGJ8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR51S1 Rabbit Polyclonal Antibody (orb587686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004758
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M2352-03W-PE 200 µL
MAP Kinase 14 (Thr180/Tyr182) (Mitogen-activated Protein Kinase 14, MAPK 14, MAPK14, Mitogen-activated Protein Kinase p38alpha, MAP Kinase p38alpha, Cytokine Suppressive Anti-inflammatory Drug binding Protein, CSAID Binding Protein, CSBP, MAX-interacting Protein 2, MAP Kinase MXI2, SAPK2A) (PE) discontinued
Sign In for Pricing
View Details 
AGC-15-1 1 Kit
15nm AptamerREADY Gold Nanoparticle Conjugation Kit (3 reactions)
Sign In for Pricing
View Details