Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52E6 Peptide - C-terminal region

OR52E6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-58

UniProt

Q96RD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52E6 Rabbit Polyclonal Antibody (orb587689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005167

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHIRETVLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRPX Rabbit Polyclonal Antibody
TA369351 100 µL

SRPX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), Biotin conjugate, 0.1mg/mL
BNCB2218-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ankrd1 Mouse Gene Knockout Kit (CRISPR)
KN301262LP 1 Kit

Ankrd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lipoprotein lipase Recombinant Rabbit Monoclonal Antibody [JA22-02]
ET1704-48 100 µL

Lipoprotein lipase Recombinant Rabbit Monoclonal Antibody [JA22-02]

Sign In for Pricing
View Details
SIRT1 (NM_012238) Human Over-expression Lysate
LC402173 20 µg

SIRT1 (NM_012238) Human Over-expression Lysate

Sign In for Pricing
View Details
NUDT10 Human qPCR Primer Pair (NM_153183)
HP218044 200 Reactions

NUDT10 Human qPCR Primer Pair (NM_153183)

Sign In for Pricing
View Details