Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52E6 Peptide - C-terminal region

OR52E6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-58

UniProt

Q96RD3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52E6 Rabbit Polyclonal Antibody (orb587689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005167

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHIRETVLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eriodictyol
TRC-E600085-2.5MG 2.5 mg

Eriodictyol

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS801301 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
GDNF (NM_199234) Human Recombinant Protein
TP760516 50 µg

GDNF (NM_199234) Human Recombinant Protein

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), Biotin conjugate, 0.1mg/mL
BNCB1864-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL
BNC041924-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Tendon
CS634589 5x 5 µm

Frozen Tissue Sections, Tendon

Sign In for Pricing
View Details