Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52I2 Peptide - N-terminal region

OR52I2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-12

UniProt

Q8NH67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52I2 Rabbit Polyclonal Antibody (orb587690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Necrofibrin (Rat)
CCP2648-01 1 mg

Necrofibrin (Rat)

Sign In for Pricing
View Details
Necrofibrin (Rat)
CCP2648-02 5 mg

Necrofibrin (Rat)

Sign In for Pricing
View Details
Necrofibrin (Rat)
CCP2648-03 10 mg

Necrofibrin (Rat)

Sign In for Pricing
View Details
CD34 (TUK3) : m-IgG3 BP-HRP Bundle
sc-550372 1 Kit

CD34 (TUK3) : m-IgG3 BP-HRP Bundle

Sign In for Pricing
View Details
Human Bcl2 Associated X Protein (Bax) ELISA Kit
RDR-Bax-Hu-48Tests 48 Tests

Human Bcl2 Associated X Protein (Bax) ELISA Kit

Sign In for Pricing
View Details
Anti-BAG3 Antibody (8D844)
TMAH-00102-01 50 μL

Anti-BAG3 Antibody (8D844)

Sign In for Pricing
View Details