Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR52I2 Peptide - N-terminal region

OR52I2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OR11-12

UniProt

Q8NH67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR52I2 Rabbit Polyclonal Antibody (orb587690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA4 Protein Lysate
OCOA04365-20UG 20 µg

EFNA4 Protein Lysate

Sign In for Pricing
View Details
ATP-sensitive inward rectifier potassium channel 15 (KCNJ15) Guinea Pig ELISA Kit
B7449 96 Tests

ATP-sensitive inward rectifier potassium channel 15 (KCNJ15) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
ZNF667, ID (ZNF667, Zinc finger protein 667) (MaxLight 650) discontinued
044324-ML650 100 µL

ZNF667, ID (ZNF667, Zinc finger protein 667) (MaxLight 650) discontinued

Sign In for Pricing
View Details
HECTD4 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2499589 100 µL

HECTD4 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Usp10 3'UTR GFP Stable Cell Line
TU171643 1.0 mL

Usp10 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Efna4 shRNA (UAS) - Lentiviral mouse Efna4 shRNA (UAS) plasmid
GTR15261607 1 Vial

Lentiviral mouse Efna4 shRNA (UAS) - Lentiviral mouse Efna4 shRNA (UAS) plasmid

Sign In for Pricing
View Details