Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCYOX1L Peptide - C-terminal region

PCYOX1L Peptide - C-terminal region

Product Specifications

UniProt

Q8NBM8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCYOX1L Rabbit Polyclonal Antibody (orb327075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076933

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF647 conjugate, 0.1mg/mL
BNC470324-500 1x 500 µL

CD53 (161-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-500 1x 500 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF488A conjugate, 0.1mg/mL
BNC881135-100 1x 100 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details