Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYHD1 Peptide - C-terminal region

PHYHD1 Peptide - C-terminal region

Product Specifications

UniProt

Q5SRE7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHYHD1 Rabbit Polyclonal Antibody (orb587704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT1 (TRMU) Mouse Monoclonal Antibody [Clone ID: OTI1C6]
TA505698S 30 µL

TRMT1 (TRMU) Mouse Monoclonal Antibody [Clone ID: OTI1C6]

Sign In for Pricing
View Details
RAB3GAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1768807 1.0 µg DNA

RAB3GAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-Zebrafish RAB1aa/ab Antibody Picoband® Cy3 Conjugated
AZB8JLC8-Cy3 100 µg/Vial

Anti-Zebrafish RAB1aa/ab Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Olfr830 (NM_146566) Mouse Tagged ORF Clone
MR213145 10 µg

Olfr830 (NM_146566) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Colorectal Slide (Benign) (5 slides/pk)
HTS-10702 1 PK

Human Colorectal Slide (Benign) (5 slides/pk)

Sign In for Pricing
View Details
Mouse Cers4 Pre-designed siRNA Set A
SI102412A 1 Each

Mouse Cers4 Pre-designed siRNA Set A

Sign In for Pricing
View Details