Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYHD1 Peptide - C-terminal region

PHYHD1 Peptide - C-terminal region

Product Specifications

UniProt

Q5SRE7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHYHD1 Rabbit Polyclonal Antibody (orb587704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ARRDC1 Protein Lysate 20ug
IHUARRDC1PLLY20UG 20 µg

Human ARRDC1 Protein Lysate 20ug

Sign In for Pricing
View Details
C20orf85 Recombinant Protein Antigen
NBP2-31709PEP 0.1 mL

C20orf85 Recombinant Protein Antigen

Sign In for Pricing
View Details
SuLt4a1 (NM_031641) Rat Tagged Lenti ORF Clone
RR213253L3 10 µg

SuLt4a1 (NM_031641) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat C-Terminal Binding Protein 2 (CTBP2) ELISA Kit
SL1975Ra-01 48 Tests

Rat C-Terminal Binding Protein 2 (CTBP2) ELISA Kit

Sign In for Pricing
View Details
Rat C-Terminal Binding Protein 2 (CTBP2) ELISA Kit
SL1975Ra-02 96 Tests

Rat C-Terminal Binding Protein 2 (CTBP2) ELISA Kit

Sign In for Pricing
View Details
RPS27P19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784815 1.0 µg DNA

RPS27P19 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details