Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYHD1 Peptide - C-terminal region

PHYHD1 Peptide - C-terminal region

Product Specifications

UniProt

Q5SRE7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHYHD1 Rabbit Polyclonal Antibody (orb587704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bpifa2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7606802 1.0 µg DNA

Bpifa2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Cucumis melo UDP-sugar pyrophospharylase (USP), partial
MBS1291708 Inquire

Recombinant Cucumis melo UDP-sugar pyrophospharylase (USP), partial

Sign In for Pricing
View Details
Tbx10 3'UTR Lenti-reporter-Luc Vector
46299084 1.0 µg

Tbx10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ZIC2 Conjugated Antibody
orb1613286 100 µL

ZIC2 Conjugated Antibody

Sign In for Pricing
View Details
Neuro D (phospho Ser274) Polyclonal Antibody
E44H01014 100 µL

Neuro D (phospho Ser274) Polyclonal Antibody

Sign In for Pricing
View Details
STOML1 (NM_004809) Human Over-expression Lysate
LH07375V 100 µg

STOML1 (NM_004809) Human Over-expression Lysate

Sign In for Pricing
View Details