Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYHD1 Peptide - C-terminal region

PHYHD1 Peptide - C-terminal region

Product Specifications

UniProt

Q5SRE7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHYHD1 Rabbit Polyclonal Antibody (orb587704) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk2 Rabbit mAb
MBS8602559-01 0.1 mL

Chk2 Rabbit mAb

Sign In for Pricing
View Details
Chk2 Rabbit mAb
MBS8602559-02 0.1 mL (AF405L)

Chk2 Rabbit mAb

Sign In for Pricing
View Details
Chk2 Rabbit mAb
MBS8602559-03 0.1 mL (AF405S)

Chk2 Rabbit mAb

Sign In for Pricing
View Details
Chk2 Rabbit mAb
MBS8602559-04 0.1 mL (AF610)

Chk2 Rabbit mAb

Sign In for Pricing
View Details
Chk2 Rabbit mAb
MBS8602559-05 0.1 mL (AF635)

Chk2 Rabbit mAb

Sign In for Pricing
View Details
Chk2 Rabbit mAb
MBS8602559-06 0.1 mL (APC)

Chk2 Rabbit mAb

Sign In for Pricing
View Details