PLSCR5 Peptide - C-terminal region
PLSCR5 Peptide - C-terminal region
Product Specifications
UniProt
A0PG75
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLSCR5 Rabbit Polyclonal Antibody (orb327081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001078889
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SCWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7618283-01 48 Well
Human TNF-alpha (Tumor Necrosis Factor Alpha) QuickTest ELISA Kit
Sign In for Pricing
View Details MBS7618283-02 96 Well
Human TNF-alpha (Tumor Necrosis Factor Alpha) QuickTest ELISA Kit
Sign In for Pricing
View Details MBS7618283-03 5x 96 Well
Human TNF-alpha (Tumor Necrosis Factor Alpha) QuickTest ELISA Kit
Sign In for Pricing
View Details MBS7618283-04 10x 96 Well
Human TNF-alpha (Tumor Necrosis Factor Alpha) QuickTest ELISA Kit
Sign In for Pricing
View Details 252493 50 µg
TCIRG1 (T-Cell, immune Regulator 1, ATPase, H+ Transporting, Lysosomal V0 Subunit A3, ATP6N1C, ATP6V0A3, Atp6i, OC-116kD, OC116, OPTB1, Stv1, TIRC7, Vph1, a3)
Sign In for Pricing
View Details