Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR5 Peptide - C-terminal region

PLSCR5 Peptide - C-terminal region

Product Specifications

UniProt

A0PG75

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR5 Rabbit Polyclonal Antibody (orb327081) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078889

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SCWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Tubulin Antibody
MBS856731-01 0.1 mL

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
MBS856731-02 0.1 mL (Biotin)

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
MBS856731-03 0.1 mL (FITC)

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
MBS856731-04 0.1 mL (AF350)

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
MBS856731-05 0.1 mL (AF405)

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
MBS856731-06 0.1 mL (AF488)

Beta-Tubulin Antibody

Sign In for Pricing
View Details