Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPTC7 Peptide - C-terminal region

PPTC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA-PP2C, TAPP2C

UniProt

Q8NI37

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPTC7 Rabbit Polyclonal Antibody (orb587714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644812

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jak3 Rat siRNA Oligo Duplex (Locus ID 25326)
SR507664 1 Kit

Jak3 Rat siRNA Oligo Duplex (Locus ID 25326)

Sign In for Pricing
View Details
Rel B/RELB Rabbit Polyclonal Antibody (PE)
orb2619063 100 µg

Rel B/RELB Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Pur B (PURB) (NM_033224) Human Tagged ORF Clone Lentiviral Particle
RC211001L3V 200 µL

Pur B (PURB) (NM_033224) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Valemetostat (DS-3201)
C13788-1g 1 g

Valemetostat (DS-3201)

Sign In for Pricing
View Details
GABAA Rα5 Lentiviral Activation Particles (h2)
sc-402696-LAC-2 200 µL

GABAA Rα5 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
ZDHHC2 Double Nickase Plasmid (m)
sc-427736-NIC 20 µg

ZDHHC2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details