Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPTC7 Peptide - C-terminal region

PPTC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA-PP2C, TAPP2C

UniProt

Q8NI37

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPTC7 Rabbit Polyclonal Antibody (orb587714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644812

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Khellinol
HY-119713 1 mg

Khellinol

Sign In for Pricing
View Details
N- (2-Hydroxypropyl) pyridine-3-carboxamide hydrochloride
UFC04146-01 50 mg

N- (2-Hydroxypropyl) pyridine-3-carboxamide hydrochloride

Sign In for Pricing
View Details
N- (2-Hydroxypropyl) pyridine-3-carboxamide hydrochloride
UFC04146-02 0.5 g

N- (2-Hydroxypropyl) pyridine-3-carboxamide hydrochloride

Sign In for Pricing
View Details
RGD1309492 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6238805 3x 1.0 µg

RGD1309492 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SERPINH1 ORF Vector (Human) (pORF)
ORF009400 1.0 µg DNA

SERPINH1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MELK Antibody
MBS9604740-01 0.1 mL

MELK Antibody

Sign In for Pricing
View Details