Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPTC7 Peptide - C-terminal region

PPTC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA-PP2C, TAPP2C

UniProt

Q8NI37

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPTC7 Rabbit Polyclonal Antibody (orb587715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_644812

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACD

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHRH Rabbit pAb, PE-Cy5 conjugated
orb2890235 100 µL

GHRH Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Recombinant Human NT5M Protein
E30P66643B 50 µg

Recombinant Human NT5M Protein

Sign In for Pricing
View Details
Recombinant Human FOXE3 Protein, N-GST & C-His
HB514012-01 50 µg

Recombinant Human FOXE3 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human FOXE3 Protein, N-GST & C-His
HB514012-02 100 µg

Recombinant Human FOXE3 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human FOXE3 Protein, N-GST & C-His
HB514012-03 1 mg

Recombinant Human FOXE3 Protein, N-GST & C-His

Sign In for Pricing
View Details
MAS1 (G-1) Alexa Fluor® 647
sc-390453 AF647 200 µg/mL

MAS1 (G-1) Alexa Fluor® 647

Sign In for Pricing
View Details