PRAMEF7 Peptide - N-terminal region
PRAMEF7 Peptide - N-terminal region
Product Specifications
UniProt
Q5VXH5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF7 Rabbit Polyclonal Antibody (orb327085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012277
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATASFPEALSQKQTADNCPGTGRQQPFMVFIDLCLKNRTLDECLTHLLEW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CEBP Alpha (CEBPA) Mouse Monoclonal Antibody [Clone ID: 5B7]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbf21/imageurl/am06759su-n.webp)
AM06759SU-N 100 µL
CEBP Alpha (CEBPA) Mouse Monoclonal Antibody [Clone ID: 5B7]
Sign In for Pricing
View Details