Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF38B Peptide - middle region

PRPF38B Peptide - middle region

Product Specifications

UniProt

Q5VTL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF38B Rabbit Polyclonal Antibody (orb327088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magec2 (NM_001025713) Rat Tagged Lenti ORF Clone
RR211555L4 10 µg

Magec2 (NM_001025713) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human Retinol Binding Protein-4 His Tag
7-01538 10 µg

Recombinant Human Retinol Binding Protein-4 His Tag

Sign In for Pricing
View Details
PHBP1-set siRNA/shRNA/RNAi Lentivector (Human)
36532091 4x 500 ng

PHBP1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
MM-22
456393-01 1 mg

MM-22

Sign In for Pricing
View Details
MM-22
456393-02 2.5 mg

MM-22

Sign In for Pricing
View Details
Carbonyl reductase 1 (B-11) PE
sc-390554 PE 200 µg/mL

Carbonyl reductase 1 (B-11) PE

Sign In for Pricing
View Details