Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF38B Peptide - middle region

PRPF38B Peptide - middle region

Product Specifications

UniProt

Q5VTL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPF38B Rabbit Polyclonal Antibody (orb327088) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQLYELKTYHEVVDEIYFKVTHVEPWEKGSRKTAGQTGMCGGVRGVGTGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycogen Synthase Kinase 3 alpha, phosphorylated (Ser21) (GSK3a) (FITC) discontinued
G8170-42B-FITC 100 µL

Glycogen Synthase Kinase 3 alpha, phosphorylated (Ser21) (GSK3a) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Human TFF2 Protein, N-His
orb2968119-01 50 µg

Recombinant Human TFF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TFF2 Protein, N-His
orb2968119-02 100 µg

Recombinant Human TFF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TFF2 Protein, N-His
orb2968119-03 1 mg

Recombinant Human TFF2 Protein, N-His

Sign In for Pricing
View Details
Filaggrin (FLG) Human shRNA Plasmid Kit (Locus ID 2312)
TL315493 1 Kit

Filaggrin (FLG) Human shRNA Plasmid Kit (Locus ID 2312)

Sign In for Pricing
View Details
CDKN1B/p27 KIP 1 Mouse Monoclonal Antibody (Cy7)
orb2367597 100 µL

CDKN1B/p27 KIP 1 Mouse Monoclonal Antibody (Cy7)

Sign In for Pricing
View Details