Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS38 Peptide - C-terminal region

PRSS38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPN2

UniProt

A1L453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS38 Rabbit Polyclonal Antibody (orb327091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_898885

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A25 3'UTR Luciferase Stable Cell Line
TU023503 1.0 mL

SLC25A25 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 gamma Antibody, AbBy Fluor™ 555 Conjugated
bs-2477R-BF555-01 20 µL

Macrophage Inflammatory Protein 1 gamma Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 gamma Antibody, AbBy Fluor™ 555 Conjugated
bs-2477R-BF555-02 100 µL

Macrophage Inflammatory Protein 1 gamma Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
DOK2 Rabbit Polyclonal Antibody (FITC)
orb2081169 100 µL

DOK2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse IL-26 elisa kit
OM626259 96 Tests

Mouse IL-26 elisa kit

Sign In for Pricing
View Details
Lats2 (NM_153382) Mouse Tagged ORF Clone Lentiviral Particle
MR226238L4V 200 µL

Lats2 (NM_153382) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details