Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS38 Peptide - C-terminal region

PRSS38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPN2

UniProt

A1L453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS38 Rabbit Polyclonal Antibody (orb327091) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_898885

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNT2 Rabbit Polyclonal Antibody (Cy5)
orb918839 100 µL

KCNT2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Rabbit Polyclonal VDAC1 Antibody
NBP3-35374-20ul 20 µL

Rabbit Polyclonal VDAC1 Antibody

Sign In for Pricing
View Details
Top2b (NM_009409) Mouse Untagged Clone
MC224750 10 µg

Top2b (NM_009409) Mouse Untagged Clone

Sign In for Pricing
View Details
SAR 245409, XL765
MBS130279-01 100 mg

SAR 245409, XL765

Sign In for Pricing
View Details
SAR 245409, XL765
MBS130279-02 500 mg

SAR 245409, XL765

Sign In for Pricing
View Details
Recombinant Acetoacetyl Coenzyme A Synthetase (AACS)
TRV-0039284-01 10 µg

Recombinant Acetoacetyl Coenzyme A Synthetase (AACS)

Sign In for Pricing
View Details