Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD5 Peptide - C-terminal region

PSMD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S5B

UniProt

Q16401

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD5 Rabbit Polyclonal Antibody (orb587725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005038

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBST Wash Buffer with Sodium Azide 10X with 0.5% Tween 20, pH 7.6
40120224-2 2 L

TBST Wash Buffer with Sodium Azide 10X with 0.5% Tween 20, pH 7.6

Sign In for Pricing
View Details
Picric Acid Solution 1.2% AR
02038 00500 500 mL

Picric Acid Solution 1.2% AR

Sign In for Pricing
View Details
Mycobacterium tuberculosis (38 kDa antigen) Mouse Monoclonal Antibody [Clone ID: BGN/1209/3875]
AM05413PU-N 200 µg

Mycobacterium tuberculosis (38 kDa antigen) Mouse Monoclonal Antibody [Clone ID: BGN/1209/3875]

Sign In for Pricing
View Details
Chk1 Checkpoint homolog (S. pombe) Adenovirus (Ad-CHK1/CHEK1)
1593 200 µL

Chk1 Checkpoint homolog (S. pombe) Adenovirus (Ad-CHK1/CHEK1)

Sign In for Pricing
View Details
Lentiviral mouse Gnai2 shRNA (UAS) - Lentiviral mouse Gnai2 shRNA (UAS, iRFP) (100)
GTR15191811 1 Vial

Lentiviral mouse Gnai2 shRNA (UAS) - Lentiviral mouse Gnai2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Cot (Phospho-Thr290) Polyclonal Conjugated Antibody
MBS9437708-01 0.1 mL (Biotin)

Cot (Phospho-Thr290) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details