Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD5 Peptide - C-terminal region

PSMD5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S5B

UniProt

Q16401

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMD5 Rabbit Polyclonal Antibody (orb587725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005038

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTCF Rabbit Polyclonal Antibody
orb592866 100 µL

CTCF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Sortase A (srtA), N-His-SUMO
VG9C134-01 1 mg

Recombinant Staphylococcus aureus Sortase A (srtA), N-His-SUMO

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Sortase A (srtA), N-His-SUMO
VG9C134-02 100 µg

Recombinant Staphylococcus aureus Sortase A (srtA), N-His-SUMO

Sign In for Pricing
View Details
Lentiviral mouse C6 shRNA (UAS) - Lentiviral mouseC6 shRNA (UAS, GFP) (25)
GTR15296687 1 Vial

Lentiviral mouse C6 shRNA (UAS) - Lentiviral mouseC6 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Monoclonal PEA-15 Antibody [Alexa Fluor 350]
NBP3-05544AF350 0.1 mL

Mouse Monoclonal PEA-15 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
DCAF7 Protein Vector (Human) (pPM-C-His)
PV072312 500 ng

DCAF7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details