Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYROXD1 Peptide - N-terminal region

PYROXD1 Peptide - N-terminal region

Product Specifications

UniProt

B3KWN8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYROXD1 Rabbit Polyclonal Antibody (orb587730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDR2 AAV Vector (Mouse) (CMV)
17786104 1 µg

DDR2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Slfn3 ORF Vector (Mouse) (pORF)
ORF057892 1.0 µg DNA

Slfn3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Diphenadol-d10
HY-A0270S-01 5 mg

Diphenadol-d10

Sign In for Pricing
View Details
Diphenadol-d10
HY-A0270S-02 1 mg

Diphenadol-d10

Sign In for Pricing
View Details
Propacetamol Hydrochloride
BUP17474 100 mg

Propacetamol Hydrochloride

Sign In for Pricing
View Details
Recombinant Human ADH7 Protein
E30P4056 20 µg

Recombinant Human ADH7 Protein

Sign In for Pricing
View Details